SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007489 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007489
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000741
Family THAP domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007489   Gene: ENSPPYG00000006605   Transcript: ENSPPYT00000007793
Sequence length 257
Comment pep:known chromosome:PPYG2:15:68182983:68195170:-1 gene:ENSPPYG00000006605 transcript:ENSPPYT00000007793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARCVAAHCGNTTKSGKSLFRFPKDRAVRLLWDRFVRGCRADWYGGNDRSVICSDHFAP
ACFDVSSVIQKNLRFSQRLRLVAGAVPTLHRVPAPAPKGGEEGDQAGRPDTRGELQAARH
SEAAPGPVSCTRPRAGKQAAASQITCENEVVQTQPHADNPSNTVTSVPTHCEEGPMHKST
QISLKRPRHRSVGIQAKVKAFGKRLCNATTQTEELWSRTSSLFDIYSSDSEIDTDWDIKS
EQSDLSYIAVQVKEETC
Download sequence
Identical sequences H2NNM7
ENSPPYP00000007489 ENSPPYP00000007489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]