SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007649 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007649
Domain Number 1 Region: 2-178
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.41e-54
Family BAR domain 0.000000893
Further Details:      
 
Domain Number 2 Region: 221-281
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-21
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007649   Gene: ENSPPYG00000006741   Transcript: ENSPPYT00000007960
Sequence length 284
Comment pep:known_by_projection chromosome:PPYG2:15:80892000:80954797:1 gene:ENSPPYG00000006741 transcript:ENSPPYT00000007960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSEKISGAEGTKLDDEFLDMARKIDVTNKVVAEILSKTTEYLQPNPGNALIEVGESMKL
MAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEV
RQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHKQSTEILQELQSKLQMR
ISAASSVPRREYKPRPVKRSSSELNGVSTTSVAKTTGSNIPVDQPCCRGLYDFEPENQGE
LGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ
Download sequence
Identical sequences H2NP29
9600.ENSPPYP00000007649 ENSPPYP00000007649 ENSPPYP00000007649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]