SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007720 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007720
Domain Number 1 Region: 970-1264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.65e-79
Family Protein kinases, catalytic subunit 0.0000000000972
Further Details:      
 
Domain Number 2 Region: 326-492
Classification Level Classification E-value
Superfamily L domain-like 9.36e-52
Family L domain 0.0000000548
Further Details:      
 
Domain Number 3 Region: 33-188
Classification Level Classification E-value
Superfamily L domain-like 2.84e-42
Family L domain 0.000000107
Further Details:      
 
Domain Number 4 Region: 488-607
Classification Level Classification E-value
Superfamily Fibronectin type III 3.14e-31
Family Fibronectin type III 0.0000118
Further Details:      
 
Domain Number 5 Region: 783-925
Classification Level Classification E-value
Superfamily Fibronectin type III 2.06e-21
Family Fibronectin type III 0.0000893
Further Details:      
 
Domain Number 6 Region: 610-690,789-827
Classification Level Classification E-value
Superfamily Fibronectin type III 5.08e-21
Family Fibronectin type III 0.00021
Further Details:      
 
Domain Number 7 Region: 169-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.32e-16
Family Growth factor receptor domain 0.0000000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007720   Gene: ENSPPYG00000006808   Transcript: ENSPPYT00000008036
Sequence length 1367
Comment pep:known chromosome:PPYG2:15:95736793:96055774:1 gene:ENSPPYG00000006808 transcript:ENSPPYT00000008036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSACGKRACTENNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRH
NYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASKFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPAFL
EIISSIKDEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
Download sequence
Identical sequences H2NP98
ENSPPYP00000007720 XP_009248462.1.23681 ENSPPYP00000007720 9600.ENSPPYP00000007720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]