SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007960 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007960
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-38
Family SCAN domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 471-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 583-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 629-681
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 5 Region: 433-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 512-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000018
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 211-265
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000051
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 
Domain Number 8 Region: 374-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000488
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007960   Gene: ENSPPYG00000007038   Transcript: ENSPPYT00000008291
Sequence length 683
Comment pep:known chromosome:PPYG2:16:3394796:3404525:1 gene:ENSPPYG00000007038 transcript:ENSPPYT00000008291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGPVSQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRQQVTNHGRGTEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQ
RDPQAVKERALSAPWLSLFPPEGNVEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRA
LSRDTVQESYENVDSLESHIPSQEVPGTQVGQGGKLWDPSVQSCKEGLSPRGPAPGEEKF
ENLEGVPSVSSENIHPQVLLPDQARGEVPWSPELGRPRDRPQGDWAPPPEGGMEQALAGA
SSGRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVDCSEIFGGNSR
FLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCFSCNSNLHRH
QRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHERTH
ERERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTGE
KPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYK
CSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences H2NPY3
ENSPPYP00000007960 ENSPPYP00000007960 9600.ENSPPYP00000007960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]