SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008040 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008040
Domain Number 1 Region: 44-171
Classification Level Classification E-value
Superfamily TPR-like 2.14e-17
Family Tetratricopeptide repeat (TPR) 0.0038
Further Details:      
 
Domain Number 2 Region: 846-885
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000117
Family HkH motif-containing C2H2 finger 0.075
Further Details:      
 
Domain Number 3 Region: 904-932
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000455
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number 4 Region: 768-801
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000471
Family CCCH zinc finger 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008040
Domain Number - Region: 630-660
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.014
Family CCCH zinc finger 0.0077
Further Details:      
 
Domain Number - Region: 504-532
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0608
Family CCCH zinc finger 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008040   Gene: ENSPPYG00000007111   Transcript: ENSPPYT00000008373
Sequence length 971
Comment pep:known_by_projection chromosome:PPYG2:16:12136175:12167787:-1 gene:ENSPPYG00000007111 transcript:ENSPPYT00000008373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLRALVRNLFNEGNDVYRERDWN
NSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSLNA
SNCKALYRKSKALSDLGRYKKAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVR
AELSLKSVPGDGATKALNHSVEDIEPDLLTPRQEAVPVVSLPAPSFSHEVGSELASVPVM
PLTSILPLQVEESALPSAVLANGGKMPFSMPEAFLDDGDMVLGDELDDLLDSAPETNETV
MPSALVRGPLQTASVSPSMPFSASLLGTLPIGARYAPPPSFSEFYPPLTSSLEDFCSSLN
SFSMSESKRDLSTSTSREGTPLNNSNSSLLLMNGPGSLFASENFLGISSQPRNDFGNFFG
SAVTKPSSSVTPRHPLEGTHELRQACQICFVKSGPKLMDFTYHANIDHKCKKDILIGRIK
NVEDKSWKKIRPRPTKTNYEGPYYICKDVAAEEECRYSGHCTFAYCQEEIDVWTLERKGA
FSREAFFGGNGKINLTVFKLLQEHLGEFIFLCEKCFDHKPRMISKRNKDNSTACSHPVTK
HEFEDNKCLVHILRETTVKYSKIRSFHGQCQLDLCRHEVRYGCLREDECFYAHSLVELKV
WIMQNETGISHDAIAQESKRYWQNLEANVPGAQVLGNQIMPGFLNMKIKFVCAQCLRNGQ
VIEPDKNRKYCSAKARHSWTKDRRAMRVMSIERKKWMNIRPLPTKKQMPLQFDLCNHIAS
GKKCQYVGNCSFAHSPEEREVWTYMKENGIQDMEQFYELWLKSQKNEKSEDVASQSNKEN
GKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFP
TGYFSICDRYMNGTCPEGNSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIGPNDNDF
GKYSFLFKDLN
Download sequence
Identical sequences H2NQ61
ENSPPYP00000008040 ENSPPYP00000008040 XP_002826182.1.23681 XP_009248754.1.23681 9600.ENSPPYP00000008040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]