SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008283 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008283
Domain Number 1 Region: 175-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000441
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 2 Region: 137-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000149
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 930-981
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000358
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 4 Region: 779-827
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000456
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 5 Region: 632-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000551
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 691-739
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000699
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 7 Region: 1228-1278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000007
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 8 Region: 480-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000783
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 9 Region: 1166-1220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000493
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008283
Domain Number - Region: 296-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000541
Family Classic zinc finger, C2H2 0.056
Further Details:      
 
Domain Number - Region: 408-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0014
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number - Region: 748-774
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00289
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 63-86
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00404
Family Classic zinc finger, C2H2 0.055
Further Details:      
 
Domain Number - Region: 261-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0041
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 882-939
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0148
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008283   Gene: ENSPPYG00000007334   Transcript: ENSPPYT00000008622
Sequence length 1284
Comment pep:known_by_projection chromosome:PPYG2:16:36495875:36832429:-1 gene:ENSPPYG00000007334 transcript:ENSPPYT00000008622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKKRVEEGEASDFSLAWDSSVTAAGGLEGEPECDRKTSRALEDRNSVTSQEERNEDDED
MEDESIYTCDHCQQDFESLADLTDHRAHRCPGDGDDDPQLSWVASSPSSKDVASPTQMIG
DGCDLGLGEEEGGTGLPYPCQFCDKSFIRLSYLKRHEQIHSDKLPFKCTYCSRLFKHKRS
RDRHIKLHTGDKKYHCHECEAAFSRSDHLKIHLKTHSSSKPFKCTVCKRGFSSTSSLQSH
MQAHKKNKEHLAKSEKEAKKDDFMCDYCEDTFSQTEELEKHVLTRHPQLSEKADLQCIHC
PEVFVDENTLLAHIHQAHANQKHKCPMCPEQFSSVEGVYCHLDSHRQPDSSNHSVSPDPV
LGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQGWTKVVYSCPYCSKRDFN
SLAVLEIHLKTIHADKPQQSHTCQICLDSMPTLYNLNEHVRKLHKNHAYPVMQFGNISAF
HCNYCPEMFADINSLQEHIRVSHCGPNANPSDGNNAFFCNQCSMGFLTESSLTEHIQQAH
CSVGSAKLESPVVQPTQSFMEVYSCPYCTNSPIFGSILKLTKHIKENHKNIPLAHSKKSK
AEQSPVSSDVEVSSPKRQRLSASANSISNGEYPCNQCDLKFSNFESFQTHLKLHLELLLR
KQACPQCKEDFDSQESLLQHLTVHYMTTSTHYVCESCDKQFSSVDDLQKHLLDMHTFVLY
HCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRKEADLQVHVKHSHLGNPAKA
HKCIFCGETFSTEVELQCHITTHSKKYNCKFCSKAFHAIILLEKHLREKHCVFDAATENG
TANGVPPTATKKAEPADLQGMLLKNPEAPNSHEASEDDVDASEPMYGCDICGAAYTMEVL
LQNHRLRDHNIRPGEDDGSRKKAEFIKGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYM
CPICGERFPSLLTLTEHKVTHSKSLDTGTCRICKMPLQSEEEFIEHCQMHPDLRNSLTGF
RCVVCMQTVTSTLELKIHGTFHMQKLAGSSAASSPNGQGLQKLYKCALCLKEFRSKQDLV
KLDVNGLPYGLCAGCMARSANGQVGGLAPPEPADRPCAGLRCPECSVKFESAEDLESHMQ
MDHRDLTPETSGPRKGTQTSPVPRKKTYQCIKCQMTFENEREIQIHVANHMIEEGINHEC
KLCNQMFDSPAKLLCHLIEHSFEGMGGTFKCPVCFTVFVQANKLQQHIFAVHGQEDKIYD
CSQCPQKFFFQTELQNHTMSQHAQ
Download sequence
Identical sequences H2NQU8
9600.ENSPPYP00000008283 ENSPPYP00000008283 ENSPPYP00000008283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]