SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008606 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008606
Domain Number 1 Region: 240-359
Classification Level Classification E-value
Superfamily PX domain 8.28e-16
Family PX domain 0.0036
Further Details:      
 
Domain Number 2 Region: 441-495
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000314
Family SAM (sterile alpha motif) domain 0.0059
Further Details:      
 
Domain Number 3 Region: 987-1017
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000436
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008606   Gene: ENSPPYG00000007629   Transcript: ENSPPYT00000008954
Sequence length 1041
Comment pep:known_by_projection chromosome:PPYG2:16:75128512:75218751:-1 gene:ENSPPYG00000007629 transcript:ENSPPYT00000008954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGGGGPSAALREQERVYEWFGLVLGSAQRLEFMCGLLDLCIPLELRFLGSCLEDLARK
DYHSLRDSEIKANNPADLGSLTNLTDEVVRSKLLVSLALLGSEQREAAGVLYRTLTHIDS
IIHNYGLQLNEGRTGDEFLLLFTMASNHPAFSFHQKQVLRQELTQIQSSLNGGGGHGGKG
APGPGGALPTCPACHKITPRTEAPVSSVSNSLENALHTSAHSTEESLPKRPLGKHSKVSV
EKIDLKGLSHTKNDRNVECSFEVLWSDSSITSVTKSSSEVTEFISKLSQLYPEENLEKLI
PCLAGPDAFYVERNHVDLDSGLRYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPP
LSKVGTVMGVSGRPVCGVAGIPSSQSGAQHHGQHPAGSAAPLPHCSHAGSAGSALAYRTQ
MDTSPAILMPSSLQTPQTQEQNGILDWLRKLRLHKYYPVFKQLSMEKFLSLTEEDLNKFE
SLTMGAKKKLKTQLELEKEKSERRCLNPSAPSLVTSSGVARVPPTSHVGPVQSGRGSHAA
ELRVEVEQPHHQLPREGSSSEYSSSSSSPMGVQAREESSDSAEENDRRVEIHLESSDKEK
PVMLLNHFTSSSARPTAQVLPVQNEASSNPSGHHPLPPQMLSAASHIAPIRMLNSVHKPE
RGSADMKLLSSSVHSLLSLEERNKGSGPRSSMKVDKSFGSAMMDVLPTSAPHQPVQVLSG
LSESSSMSPTVSFGPRTKVVHASTLDRVLKTAQQPALVVETSTATTGTPSTVLHAARPPI
KLLLSSSVPADSAISGQTSCPNNVQISVPPAIINPRTALYTANTKVAFSAMSSMPVGPLQ
GGFCANSNTASPSSHPSTSFANMATLPSCPAPSSSPALSSVPESSFYSSSGGGGSTGNIP
ASNPNHHHHHQQPPAPPQPAPFSPMCSSGYVSAQYGGGSFPVVHAPYSSSGTPDPVSGQS
TFAVPPMQNFMAGTAGVYQTQGLVGSSNGSSHKKSGNLSCYNCGATGHRAQDCKQPSMDF
NRPGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences H2NRQ4
ENSPPYP00000008606 ENSPPYP00000008606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]