SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008918 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008918
Domain Number 1 Region: 48-125
Classification Level Classification E-value
Superfamily HMG-box 4.19e-26
Family HMG-box 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008918   Gene: ENSPPYG00000007929   Transcript: ENSPPYT00000009283
Sequence length 232
Comment pep:known_by_projection chromosome:PPYG2:17:7600871:7602167:-1 gene:ENSPPYG00000007929 transcript:ENSPPYT00000009283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPGSSQDQAWSLEPPAPTAAASSSSGPQEREDAGSPAAPGALPLEKVKRPMNAFMVWS
SAQRRQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHRDYPDYKYRPR
RKAKSSGAGLSRCGQGRGNLASGGPLWGPGYATTQPSRGFGYRPPNYSTAYLPGSYGSSH
CKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLSGAPMPLTHL
Download sequence
Identical sequences H2NSK7
ENSPPYP00000008918 ENSPPYP00000008918 9600.ENSPPYP00000008918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]