SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008961 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008961
Domain Number 1 Region: 287-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000226
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 2 Region: 95-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000122
Family APC10-like 0.06
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008961
Domain Number - Region: 202-288
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 0.0392
Family Aconitase iron-sulfur domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008961   Gene: ENSPPYG00000007969   Transcript: ENSPPYT00000009327
Sequence length 337
Comment pep:known_by_projection chromosome:PPYG2:17:9059527:9207632:1 gene:ENSPPYG00000007969 transcript:ENSPPYT00000009327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAF
GKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCW
QSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWGAPSSFYST
QCRKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQ
DWVTATDIRVAFSRLHTFGDENEDDSELARDSYFYVGVPNLQVGGRCKCNGHAARCVRDR
DRQPGCACRHNTAGRHCHYCKEGYYRDMGKPITHRKA
Download sequence
Identical sequences H2NSP8
9600.ENSPPYP00000008961 ENSPPYP00000008961 ENSPPYP00000008961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]