SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009020 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009020
Domain Number 1 Region: 44-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.32e-37
Family SCAN domain 0.0000545
Further Details:      
 
Domain Number 2 Region: 461-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.72e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 657-713
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 405-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.15e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 600-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 544-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 702-754
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.4e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 165-224
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.32e-19
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 9 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-17
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 10 Region: 507-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000234
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009020   Gene: ENSPPYG00000008021   Transcript: ENSPPYT00000009386
Sequence length 761
Comment pep:known_by_projection chromosome:PPYG2:17:16891020:16911016:-1 gene:ENSPPYG00000008021 transcript:ENSPPYT00000009386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASSKRMNSSSRSQILLRWKSDKAQSGPYNVEKEILTSRFLRDTETCRQNFRNFPYPDL
AGPRKALSQLRELCLKWLRPEIHSKEQILELLVLEQFLTILPGEVRTWVKSQYPESSEEA
VTLVEDLTQILEEEAPQNSTLSQDTPEEDPRGKHAFQTGWLNDLVTKESMTFKDVAVDIT
QEDWELMRPVQKELYKTVTLQNYWNMVSLGLTVYRPTVIPILEEPWMVIKEILEGPSPEW
ETKAQACTPVEDMSKLTKEETQTIKLEDSYDYDDRLERRATGGFWKIHTNERGFSLKSAL
SQEYDPTEECLSKYDIYRNNFEKHSNLIVQFDTQLDNKTSVYNEGRATFNHVSYGIVHRK
ILPGEKPYKCNVCGKKFRKYPSLLKHQSTHAKEKSYECEECGKEFRHISSLIAHQRMHTG
EKPYECHQCGKAFSQRAHLTIHQRIHTGEKPYKCDDCGKDFSQRAHLTIHQRTHTGEKPY
KCLECGKTFSHSSSLINHQRVHTGEKPYICNECGKTFSQSTHLLQHQKIHTGKKPYKCNE
CWKVFSQSTYLIRHQRIHSGEKCYKCNECGKAFAHSSTLIQHQTTHTGEKSYICNICGKA
FSQSANLTQHHRTHTGEKPYKCSVCGKAFSQSVHLTQHQRIHNGEKPFKCNICGKAYRQG
ANLTQHQRIHTGEKPYKCNECGKAFIYSSSLNQHQRTHTGERPYKCNECDKDFSQRTCLI
QHQRIHTGEKPYACRICGKTFTQSTNLIQHQRVHTGAKHRN
Download sequence
Identical sequences H2NSV4
ENSPPYP00000009020 ENSPPYP00000009020 9600.ENSPPYP00000009020 XP_009249611.1.23681 XP_009249612.1.23681 XP_009249613.1.23681 XP_009249614.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]