SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009374 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009374
Domain Number 1 Region: 282-382
Classification Level Classification E-value
Superfamily HMG-box 6.81e-24
Family HMG-box 0.00000155
Further Details:      
 
Domain Number 2 Region: 555-653
Classification Level Classification E-value
Superfamily HMG-box 2.09e-22
Family HMG-box 0.00000378
Further Details:      
 
Domain Number 3 Region: 103-185
Classification Level Classification E-value
Superfamily HMG-box 2.75e-21
Family HMG-box 0.00000347
Further Details:      
 
Domain Number 4 Region: 194-273
Classification Level Classification E-value
Superfamily HMG-box 9.69e-19
Family HMG-box 0.001
Further Details:      
 
Domain Number 5 Region: 392-469
Classification Level Classification E-value
Superfamily HMG-box 7.2e-17
Family HMG-box 0.00000966
Further Details:      
 
Domain Number 6 Region: 480-559
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000144
Family HMG-box 0.00000536
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009374
Domain Number - Region: 668-699
Classification Level Classification E-value
Superfamily ARM repeat 0.00806
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009374   Gene: ENSPPYG00000008337   Transcript: ENSPPYT00000009751
Sequence length 764
Comment pep:known_by_projection chromosome:PPYG2:17:45237158:45250727:1 gene:ENSPPYG00000008337 transcript:ENSPPYT00000009751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAF
KDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYF
RFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFR
EDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDVSVRXVKDSLGKQWSQLSDK
KRLKWIHKALEQRKEYEEIMRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKP
PPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLR
FLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEE
KRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYKAREAALKAQSERKPGGEREERGK
LPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKR
YERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEI
GSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYISNKRKSMTKLR
GPNPKSSRTTLQSKSESEEDDEEDEDDEDEDEEEEDDENGDSSEDGGDSSESSSEDESED
GDENEEDDEDEDDDEDDDEDEDNESEGSSSSSSSSGDSSDSDSN
Download sequence
Identical sequences H2NTU9
ENSPPYP00000009374 ENSPPYP00000023584 9600.ENSPPYP00000009374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]