SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009445 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009445
Domain Number 1 Region: 34-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000667
Family HkH motif-containing C2H2 finger 0.045
Further Details:      
 
Domain Number 2 Region: 196-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000208
Family HkH motif-containing C2H2 finger 0.058
Further Details:      
 
Domain Number 3 Region: 278-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000238
Family Classic zinc finger, C2H2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009445   Gene: ENSPPYG00000008400   Transcript: ENSPPYT00000009825
Sequence length 422
Comment pep:known_by_projection chromosome:PPYG2:17:47396636:47424759:1 gene:ENSPPYG00000008400 transcript:ENSPPYT00000009825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGPASGAPSPLLASLPLPTRPLQPPLDFKHLLAFRFNGAAPLSLFPNFSTMDPVQKAV
ISHTFGVPYPLKKKLFISCNICHLRFNSANQAEAHYKGHKHARKLKAVEAAKSKQRPHTQ
AQDGAVVSPIPTLASGAPGEPQSKVPAVPPLGPPLQPPPTPDPTSREPAHSELLDAASSS
SSSSCPPCSPEPGREAPGPEPAAAAVGSSVSGEGRSEKGHLYCPTCKVTVNSASQLQAHN
TGAKHRWMMEGQRGAPRRSRGRPVSRGGAGHKAKRVTGGRGGRQGPSPAFHCALCQLQVN
SETQLKQHMSSRRHKDRLAGKPPKPSSQHSKLQRHAALAVSILKSKLALQKQLTKTLAAR
FLPSPLPTAATAICALPGPLALRPAPTAAATLFPAPILGPALFRTPAGAVRPATGPIVLA
PY
Download sequence
Identical sequences H2NU14
ENSPPYP00000009445 ENSPPYP00000009445 9600.ENSPPYP00000009445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]