SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009466 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009466
Domain Number 1 Region: 334-405
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.96e-22
Family Intermediate filament protein, coiled coil region 0.0014
Further Details:      
 
Domain Number 2 Region: 94-129
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000105
Family Intermediate filament protein, coiled coil region 0.0031
Further Details:      
 
Domain Number 3 Region: 12-73,397-446
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000118
Family Growth factor receptor domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009466
Domain Number - Region: 207-321
Classification Level Classification E-value
Superfamily Prefoldin 0.000288
Family Prefoldin 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009466   Gene: ENSPPYG00000008420   Transcript: ENSPPYT00000009847
Sequence length 448
Comment pep:known_by_projection chromosome:PPYG2:17:47937135:47944350:1 gene:ENSPPYG00000008420 transcript:ENSPPYT00000009847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSCCVTNNLQASLKSCPRPASVCSSGVNCRPELCLGYVCKPMACLPSVCMPTTFRPAS
CLSKTYLSSSHQAASGISGSMGPGSWYSEGAFNGNEKETMRFLNDRLASYLTMVRQLEQE
NAELESRIQEASHSQVLTMTPDYQSHFRTIEELQQKILCTKAENARMVVNIDNAKLAADD
FRAKYEAELAMRQLVEADINGLRRILDDLTLCKADLEAQVESLKEELMCLKKNHEEEVGS
LRCQLGDRLKIEVDAAPPVDLTRVLEEMRCQYEAMVEANRRDVEEWFNMQMEELNQQVAT
SSEQLQNYQSDIIDLRRTVNTLEIELQAQHSLRDSLENTLTESEARYSSQLAQMQCMITN
IEAQLAEIRADLERQNQEYQVLLDVRARLEGEINTYRSLLESEDCKLPCNPCSTPSCTPC
VPSPRVPRTVCVTRTVGVPCSPCPQGRY
Download sequence
Identical sequences H2NU35
9600.ENSPPYP00000009466 XP_002827596.1.23681 ENSPPYP00000009466 ENSPPYP00000009466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]