SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010619 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010619
Domain Number 1 Region: 945-1239
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.02e-81
Family Protein kinases, catalytic subunit 0.0000000000659
Further Details:      
 
Domain Number 2 Region: 294-459
Classification Level Classification E-value
Superfamily L domain-like 1.76e-52
Family L domain 0.0000000856
Further Details:      
 
Domain Number 3 Region: 456-579
Classification Level Classification E-value
Superfamily Fibronectin type III 2.47e-33
Family Fibronectin type III 0.000000141
Further Details:      
 
Domain Number 4 Region: 751-893
Classification Level Classification E-value
Superfamily Fibronectin type III 3.72e-24
Family Fibronectin type III 0.00000222
Further Details:      
 
Domain Number 5 Region: 33-155
Classification Level Classification E-value
Superfamily L domain-like 2.1e-22
Family L domain 0.00000178
Further Details:      
 
Domain Number 6 Region: 583-663,757-781
Classification Level Classification E-value
Superfamily Fibronectin type III 1.73e-19
Family Fibronectin type III 0.000000754
Further Details:      
 
Domain Number 7 Region: 140-296
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000173
Family Growth factor receptor domain 0.0000000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010619   Gene: ENSPPYG00000009471   Transcript: ENSPPYT00000011036
Sequence length 1305
Comment pep:known_by_projection chromosome:PPYG2:19:7232435:7424166:-1 gene:ENSPPYG00000009471 transcript:ENSPPYT00000011036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTGGRRGAAAAPLLVAMAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYID
WSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVC
PTICKSHGCTAEGLCCHSECLGNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWR
CVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVC
HLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRR
SYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNP
KLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPY
WPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWL
MRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQII
LKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQ
SEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRPSRKRRSLGDVGNVT
AAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPE
ERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRY
GDEELHLCVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVP
SNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVY
VPDEWEVPREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEF
LNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPP
TLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYR
KGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMD
GGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKA
PESEELEMEFEDMENVPYEETIPYTQLNGGKKNGGILTLPWSNPS
Download sequence
Identical sequences H2NX99
9600.ENSPPYP00000010619 ENSPPYP00000010619 ENSPPYP00000010619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]