SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010751 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010751
Domain Number 1 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.03e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 2 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-21
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 3 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-21
Family KRAB domain (Kruppel-associated box) 0.00038
Further Details:      
 
Domain Number 4 Region: 417-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-20
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 323-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.96e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 151-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-16
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 249-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000049
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010751   Gene: ENSPPYG00000009588   Transcript: ENSPPYT00000011172
Sequence length 484
Comment pep:known chromosome:PPYG2:19:11989101:12047769:1 gene:ENSPPYG00000009588 transcript:ENSPPYT00000011172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPVAFKDVAVNFTQEEWALLDISQKNLYREVMLETFRNLTSTGKKWKDQNIEYEYQNPR
RNFRSVIEERVNEIKEDSHCGETFTPVPDDRLNFQEKKASPEVKSCESFVCEVGLGNSSF
NMNIRGDTGHKAYEYQEYGPKPCKSQQPKKTFRYNPSLRTQERDHTGKKPYACKECGKNV
IYHSSTQRHMVMHSGDGPYKCKFCGKVFHCLSLYLIHERTHTGEKPYECKQCGKSFSYSA
THRIHERTHIGEKPYECQECGKAFRSPRSCHRHERSHTREKAYQCKECGKASMCPCYVRR
HERTHSRKKLYECKQCGKALSSLTSFHTHIRMHSGERLYECKTCGKGFYSAKSFQRDEKT
HSGEKPYKCKQCGKAFTRSSSFRYYESTHTGEKPYECKQCGKAFRSAPNLQLHGRTHTGE
KPYQCKECGKAFRSASQLRMHCRIHTGEKPYECKECGKAFRYVQNFRFHERTQTHKNALW
RKTL
Download sequence
Identical sequences H2NXM8
ENSPPYP00000010751 ENSPPYP00000010751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]