SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010759 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010759
Domain Number 1 Region: 445-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 195-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.61e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 277-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 333-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.48e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 105-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 389-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 487-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.46e-20
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 8 Region: 2-44
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-17
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 9 Region: 529-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000541
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 10 Region: 156-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000193
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 240-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000434
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010759   Gene: ENSPPYG00000009596   Transcript: ENSPPYT00000011181
Sequence length 573
Comment pep:known chromosome:PPYG2:19:12828560:12834172:1 gene:ENSPPYG00000009596 transcript:ENSPPYT00000011181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSVAFKDVSVSFSQEEWALLAPSQKKLYRDVMQETFKNLASIATWEAEVGESLEAGRWRL
QSHMGERLCEGKEGSQCAETFSPNLSVTKKTAGVKPYECTICGKVFMRLSSLTRHMRSHT
GYELFEKPYKCKECGKAFSYLKSFQRHERSHTGEKPYKCKQCGKTFIYHQPFQRHERTHI
GEKPYECKQCGKALSCSSSLRVHERIHTGEKPYECKQCGKAFSCSSSIRVHERTHTGEKP
YACKECGKAFISHTSVLTHMITHNGDRPYKCKECGKAFIFPSFLRVHERIHTGEKPYTCK
QCGKAFRCSTSIQIHERIHTGEKPYKCKECGKSFSARPAFRVHVRVHTGEKPYKCKECGK
AFSRISYFRIHERTHTGEKPYECKKCGKTFNYPLDLQIHKRNHTGEKPYECKECAKTFIS
LENFRRHMITHTGEGPYKCRDCGKVFIFPSALRTHERTHTGEKPYECKQCGKAFSCSSYI
RIHKRTHTGEKPYECKECGKAFIYPTSFQGHMRMHTGEKPYKCKECGKAFSLHSSFQRHT
RIHNYEKPLECKQCGKAFSLSTSLKKHMRMHNR
Download sequence
Identical sequences H2NXN6
ENSPPYP00000010759 ENSPPYP00000010759 9600.ENSPPYP00000010759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]