SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010965 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010965
Domain Number 1 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.53e-26
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 210-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.93e-23
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 4 Region: 321-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 153-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010965   Gene: ENSPPYG00000009789   Transcript: ENSPPYT00000011393
Sequence length 379
Comment pep:novel chromosome:PPYG2:19:22181898:22202112:-1 gene:ENSPPYG00000009789 transcript:ENSPPYT00000011393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEVLTFRDVAIEFSLEEWQCQDTAQQNLYRNMMLENYRNLVFLGIAASKPDLITCLEQGK
EPWNVKRHEMVAEPPVVWSYFAQDLWPKQGIKNYFQKVILRRYKKCGRENLQLRKYCKSM
DECKVHKECYNGLNQCLTTTQNKIFQCDKYVKVFHKFSNSNRHKIRHTGKKSFKCKECEK
SFCMPSHLAQHKRIHSGEKPYKCKECGKAYNEASNLSTHKRIHTGKKPYKCEECGKAFNR
LSHLTTHKIIHTGKKPYKCEECGKAFNQSANLTTHKRIHTGEKPYKCEECGKAFSQSSTL
TAHKIIHAGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKFYKCEECGKAFSRLSHLTTHK
RIHSGENPCKCEECGKTIK
Download sequence
Identical sequences H2NY86
ENSPPYP00000010965 9600.ENSPPYP00000010965 ENSPPYP00000010965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]