SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010976 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010976
Domain Number 1 Region: 10-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-23
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 2 Region: 249-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-19
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 288-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-16
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 190-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000749
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 5 Region: 152-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000183
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010976   Gene: ENSPPYG00000009801   Transcript: ENSPPYT00000011405
Sequence length 351
Comment pep:known_by_projection chromosome:PPYG2:19:24224793:24261350:1 gene:ENSPPYG00000009801 transcript:ENSPPYT00000011405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPPRSLEMGLLTFMDVAIEFSLEEWQHLDIAQQNLYRNVMLENYRNLAFLGIAVSKPD
LITSLEQGKEPWNMKRHEMVDEPSGIYPHFAQDLWPEQGMEDSFQKAILRRYEKYGHENL
QLRKGCKSVDECKVNKECYNGLNQCFTTAQSKVFQCDKYLKVFYKFLNSNRHKIRHTEKK
SLKCKKCVKSFCMLSHKTQHKSIYHREKSYKCKECGKTFNWSSTLTSHRKIYTEEKPYKC
EEYNKSPKQLSTLTTYEIIHAGEKLYKCEECGEAFNRSSTFTKHKVIHTGVKPYKCEECG
KAFFWSSSLTKHKRIHTGEQPYKWEKFGKAFNGSSHLTTDKITHWREILKV
Download sequence
Identical sequences H2NY97
ENSPPYP00000010976 9600.ENSPPYP00000010976 ENSPPYP00000010976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]