SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011003 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011003
Domain Number 1 Region: 43-156
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 249-367
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000536
Family Spermadhesin, CUB domain 0.0056
Further Details:      
 
Domain Number 3 Region: 453-490
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 164-201
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 210-249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 414-451
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011003
Domain Number - Region: 364-412
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.016
Family LDL receptor-like module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011003   Gene: ENSPPYG00000009826   Transcript: ENSPPYT00000011432
Sequence length 769
Comment pep:known_by_projection chromosome:PPYG2:19:33776503:33791360:1 gene:ENSPPYG00000009826 transcript:ENSPPYT00000011432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKRSAAGLEGAPSAREQLSVVCLVNIFLTGRLSSAVPALAACSGKLEQHTERRGVIYSP
AWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLC
GSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLP
GPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGLQDC
GDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSNLHCSWLVDTQDSRRVLLQLEL
RLGYDDYVQVYESGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHSRARSAGHGFNAT
YQVKGYCLPWEQPCGSSSDSDGGSPGGQGCFSEPQRCDDWWHCASGRDEQGCPACPPDQY
PCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQ
DGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRME
AEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSR
RRLGRLWNRLFHRPRAPRGHIPLLTAARPSQTVLGDGFLQPAPGAAPDPPAPLMDTGSTR
AAGDGPPSAPGHAPEVGPSGPPLPSGLRDPECRPVDKDRKVCREPLADGPAPADAPREPC
SAQDPHPQVSTASSTLGPHSPEPLGVCRSPPPPCSPMLEASDDEALLVC
Download sequence
Identical sequences H2NYC3
9600.ENSPPYP00000011003 ENSPPYP00000011003 ENSPPYP00000011003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]