SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011256 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011256
Domain Number 1 Region: 30-125
Classification Level Classification E-value
Superfamily Snake toxin-like 9.9e-25
Family Extracellular domain of cell surface receptors 0.024
Further Details:      
 
Domain Number 2 Region: 138-227
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000191
Family Extracellular domain of cell surface receptors 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011256   Gene: ENSPPYG00000010058   Transcript: ENSPPYT00000011695
Sequence length 355
Comment pep:known_by_projection chromosome:PPYG2:19:44691321:44696226:-1 gene:ENSPPYG00000010058 transcript:ENSPPYT00000011695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPTRKAGAQAVIWTADWLLLLLLLLLRGGAQALECYSCVQKADDGCSPNKMKTVKCAPG
VDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKL
NLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNV
TLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPQIPP
LVRLPAPEPTTVASTISVASTTSVTTSTSAPVRPTSTSKPMPAPTSQTPRQEVEHEASRD
EEPRLTGGAAGHQDRSNSGQYPAKGRPQQPHNKGCVAPMAGLAALLLAVAAGVLL
Download sequence
Identical sequences H2NZ22
ENSPPYP00000011256 XP_002829361.1.23681 ENSPPYP00000011256 9600.ENSPPYP00000011256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]