SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011274 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011274
Domain Number 1 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-24
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 177-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.99e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.37e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 512-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 121-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-17
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 9 Region: 554-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000202
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011274   Gene: ENSPPYG00000010077   Transcript: ENSPPYT00000011714
Sequence length 612
Comment pep:novel chromosome:PPYG2:19:45080665:45098353:1 gene:ENSPPYG00000010077 transcript:ENSPPYT00000011714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCLITLNNSYRMFKSCSGFSGFCASPIEESHGALISSCNSRTMTDDLESTTYETKKIFSE
NDIFEINFSQWEMKDKSKTLGLEASIFRNNWKCKSIFEGLKGHQEGYFSQMIISYEKIPS
YRKSKSLTPHQRIHNTEKSYVCKECGKACSHGSKLVQHERIHTAEKQFECKECGKNYLSA
YQLNVHQRFHTGEKPYECKECGKTFSWGSSLVKHERIHTGEKPYECKECGKAFSRGYHLT
QHQKIHIGVKSYKCKECGKAFFWGSSLAKHEIIHTGEKPYKCKECGKAFSRGYQLTQHQK
IHTGKKPYECKICGKAFCWGYQLTRHQIFHTGEKPYECKECGKAFNCGSSLIQHERIHTG
EKPYECKECGKAFSRGYHLSQHQKIHTGEKPFECKECGKAFSWGSSLVKHERVHTGEKSH
ECKECGKTFCSGYQLTRHQVFHTGEKPYECKECGKAFNCGSSLVQHERIHTGEKPYECKE
CGKAFSRGYHLTQHQKIHTGEKPFKCKECGKAFSWGSSLVKHERVHTNEKSYECKDCGKA
FGSGYQLSVHQRFHTGEKLYRCKEFGKTFTHGSKLVHERTHSNDKRYKYKECGEAFLWTT
YSNEKIDTDETL
Download sequence
Identical sequences H2NZ40
9600.ENSPPYP00000011274 ENSPPYP00000011274 ENSPPYP00000011274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]