SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011794 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011794
Domain Number 1 Region: 213-317
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 2 Region: 34-139
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 318-392
Classification Level Classification E-value
Superfamily SRCR-like 1.01e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011794   Gene: ENSPPYG00000010530   Transcript: ENSPPYT00000012248
Sequence length 392
Comment pep:known_by_projection chromosome:PPYG2:19_random:2841756:2846987:1 gene:ENSPPYG00000010530 transcript:ENSPPYT00000012248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDCAGERATPSLPLTLPHPLPSLPAALVGIQAVERLRLADGPHGCAGRLEVWHGGRWGTV
CDDGWDLRDAAVACRQLGCGGALAAPGGAFFGEGAGPVWLSELACRGNEGQLGLCHHRGW
KAHICSHEEDAGVVCAGQRVANSRDDSTSPLDGAPWPGLLVELSPSTEEPLVTNAPRPAG
SPQNTSRKKSPRPKQAKSTRAPLLMTGAPRQERLRLVSGPHRCAGRLEVWHGGRWGTVCD
DGWDLRDAAVACRELGCGGALAAPGGARFGPGAGPVWMDDVGCGGGEQALRDCPRSPWGR
SNCDHSEDAGLVCTGPAPRLRLADGPHGCAGRLEVWHGGRWGSVCDDAWDLRDAAVACRE
LGCGGALAAPGGAFFGEGSKAIILDDLRCRGN
Download sequence
Identical sequences H2P0J4
ENSPPYP00000011794 ENSPPYP00000011794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]