SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011796 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011796
Domain Number 1 Region: 194-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-23
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 2 Region: 156-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 240-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011796
Domain Number - Region: 111-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000803
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011796   Gene: ENSPPYG00000010532   Transcript: ENSPPYT00000012250
Sequence length 295
Comment pep:known_by_projection chromosome:PPYG2:19_random:3044829:3049464:1 gene:ENSPPYG00000010532 transcript:ENSPPYT00000012250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAACPGCHCWEDIWQVNIQRKRRQDMLLRQGAAISKKTLPKEKSREYSKFGKISLLSTDL
FSSIQSPNNWNPCGKNLNHNLDLIGFKRNCAKKQDECYGYGKLLQRINNGRRPNGEKPRG
CSHCEKAFTQNPALMYKPAVSDSLVYKRKRVPPTEKPHVCSECGKAFCYKSEFIRHQRSH
TGEKPYGCTDCGKAFSHKSTLIKHQRIHTGVRPFECFFCGKAFTQKSHRTEHQRTHTGER
PFVCSECGKSFGEKSYLNVHRKMHTGEKPYRCRECGKSFSQKSCLNKHWRTHTGE
Download sequence
Identical sequences H2P0J6
ENSPPYP00000011796 ENSPPYP00000011796 9600.ENSPPYP00000011796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]