SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011955 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011955
Domain Number 1 Region: 54-324
Classification Level Classification E-value
Superfamily L domain-like 7.99e-43
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 2 Region: 577-664
Classification Level Classification E-value
Superfamily Fibronectin type III 4.19e-17
Family Fibronectin type III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011955   Gene: ENSPPYG00000010694   Transcript: ENSPPYT00000012426
Sequence length 739
Comment pep:known_by_projection chromosome:PPYG2:20:523106:536195:-1 gene:ENSPPYG00000010694 transcript:ENSPPYT00000012426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQTLLLLLLTVLRPSWADPPQEKVPLFRVTQQGLWGSSGSNATDSPCKGLPAADATALT
LADRNLERLPGCLPRTLRSLDASHNLLRVLSTSELGHLEQLQVLTLRHNRIAALRWGPGG
PAGLHTLDLSYNQLAALPPCAGPALSSLRALALAGNPLQTLQPRAFACFPALQLLNLSCT
ALGRGAQGGIAEAAFAGEDGAPLATLEVLDLSGTFLERVESGWIRDLPKLTSLYLRKMPR
LTTLEGDIFKMTPNLRQLDCQDSPALASVATHLFQDTPHLQVLLFQNCNLSSFPPWTLDS
SQVLLINLFGNPLTCSCDLSWLLTDAKRTVLSRAADTMCAPAAGSSGPFSASLSLSQLPG
VCQSDQSTTLWASHPPCFNRSTYAQGPTVAPSAAPATRPAGDQQSVSKAPNVGSRTIAAW
QHSDAREGTAPSTTNSVAGHSNSSVFPRAASTTRTQHRGEHAPGLVLEPDISAASTPLAS
KFLGPFPTSWNRISSPQPDQRTHATHQAPNPSPSEGEIPVLLLDDYSEEEEGRKEEVGTP
HQDVPCDYHPCKHLQTPCAELQRRWRCRCPGLSGEDTIPDPPRLQGVTETTDTSALVHWC
APNSVVHGYQIRYSAEGWAGNQSVVGVIYATARQHPLYGLSPGTTYRVCVLAANRAGLSQ
PRPSGWRSPCAAFTTKPSFALLLSGLCAASGLLLASTVVLSACLCRRGQTLRLQRCDTHL
VAYKNPTFDDYPLGLQTVS
Download sequence
Identical sequences H2P0Z9
ENSPPYP00000011955 XP_002829992.1.23681 9600.ENSPPYP00000011955 ENSPPYP00000011955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]