SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012106 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012106
Domain Number 1 Region: 418-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 2 Region: 362-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 3 Region: 306-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.39e-22
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 265-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.94e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 459-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.14e-17
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 60-103
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-17
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012106   Gene: ENSPPYG00000010840   Transcript: ENSPPYT00000012584
Sequence length 508
Comment pep:known_by_projection chromosome:PPYG2:20:25816403:25842285:1 gene:ENSPPYG00000010840 transcript:ENSPPYT00000012584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLPYPSALGDQYWEEILLSKNRENVETMKKLTQNHKAKGLPSNDTDWPQKKEGKAQIVV
PVTFRDVTVIFTEAEWKRLSPEQRNLYKEVMLENYRNLLSLAEPKPEIYTCSSCLLAFSC
QQFLSQHVLQIFLGLCAENHFHPGNSSPGHWKQQGQQYSHLSCWYENAEGQERGGGSKPW
SARTEERETSRAFPSPLQRQSASPRKGNMVVEIEPSSAQRPNPVQLDKGLKELETLRFGA
INCRECEPDHNLESNFITNPRTLLGKKPYICSDCGRSFKDRSALIRHHRIHSMEKPYVCS
ECGRGFSQKSNLSRHQRTHSEEKPYLCRECGQSFRSKSILNRHQWTHSEEKPYVCSECGR
GFSEKSSFIRHQRTHSGEKPYVCLECGRGFCDKSTLRKHQRIHSGEKPYVCKECGRGFSQ
NSDLIKHQRTHLDEKPYVCGECGRGFCDKSTLIIHERTHSGEKPYVCGECGRGFSRKSLL
LVHQRTHSGEKHYVCRECRRGFSQKSNL
Download sequence
Identical sequences H2P1E7
ENSPPYP00000012106 ENSPPYP00000012106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]