SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013046 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013046
Domain Number 1 Region: 215-356
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-42
Family Third domain of FERM 0.000000431
Further Details:      
 
Domain Number 2 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 1.06e-37
Family Second domain of FERM 0.000000679
Further Details:      
 
Domain Number 3 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-25
Family First domain of FERM 0.00000532
Further Details:      
 
Domain Number 4 Region: 503-581
Classification Level Classification E-value
Superfamily Moesin tail domain 4.97e-20
Family Moesin tail domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013046   Gene: ENSPPYG00000011694   Transcript: ENSPPYT00000013578
Sequence length 590
Comment pep:known_by_projection chromosome:PPYG2:22:24529065:24626135:1 gene:ENSPPYG00000011694 transcript:ENSPPYT00000013578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE
EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPT
YPPMNPIPAPLPPDIPSFNLVGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN
ELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKPQAQGRRPICI
Download sequence
Identical sequences H2P400
XP_003779560.1.23681 XP_009232513.1.23681 ENSPPYP00000013046 ENSPPYP00000013046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]