SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013135 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013135
Domain Number 1 Region: 29-249
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.81e-29
Family FAD-linked reductases, N-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013135   Gene: ENSPPYG00000011773   Transcript: ENSPPYT00000013671
Sequence length 684
Comment pep:known_by_projection chromosome:PPYG2:22:31585821:31608819:-1 gene:ENSPPYG00000011773 transcript:ENSPPYT00000013671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSAATPLWGPPGLLLAIALHPALSVPPRRDYCVLGAGPAGLQMAYFLQRAGRDYAVFE
RAPRPGSFFTRYPRHRKLISINKRYTGKANAEFNLRHDWNSLLSHDPRLLFRHYSRAYFP
DARDMVRYLGDFADTLGLRVQYNTTIAHVTLDKDRQAWNGHYFILTDQKGQVHQCSVLLV
ATGLSVPNQVDFPGSEYAEGYESVSVNPEDFIGQNVLILGRGNSAFETAENILGVTNFIH
MLSRSRVRLSWATHYVGDLRAINNGLLDTYQLKSLDGLLESDLTDLAILKDSKGKFHVTL
KFFLEEASTNQSADSITLPQDDNDNFAMRVPYDRVIRCLGWNFDFSIFNKSLRLNSGNAF
GKKYPLIRASYESKGSRGLFILGTASHSVDYRKSAGGFIHGFRYTVRAVHRLLEHRHHSI
TWPATKLPITQLTSSIVRRVNEASGLYQMFGVLADVILLKENSTAFEYLEEFPIQMLAQL
ETLTGRKAKHGLFVINMEYGRNFSGPDKDVFFDDRSVGHTEDAWQSNFLHPVIYYYRHLP
TEQEVRFRPAHWPLPRPTAIHHIVEDFLTDWTAPIGHILPLRRFLENCLDTDLRSFYAES
CFLFALTRQKLPPFCQQGYLRMQGLVSTESLRQHRVESRLLRDYALTGRRLEDSSQQPGD
QEPLGSPLVPGPLAQSLDSNKEEL
Download sequence
Identical sequences H2P486
9600.ENSPPYP00000013135 ENSPPYP00000013135 ENSPPYP00000013135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]