SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013367 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013367
Domain Number 1 Region: 24-466
Classification Level Classification E-value
Superfamily Sema domain 8.76e-119
Family Sema domain 0.00019
Further Details:      
 
Domain Number 2 Region: 1313-1439,1613-1799
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.47e-44
Family p120GAP domain-like 0.019
Further Details:      
 
Domain Number 3 Region: 800-894
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000215
Family Other IPT/TIG domains 0.0077
Further Details:      
 
Domain Number 4 Region: 892-981
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000266
Family Other IPT/TIG domains 0.057
Further Details:      
 
Domain Number 5 Region: 469-518
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000453
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 980-1094
Classification Level Classification E-value
Superfamily E set domains 0.00000525
Family E-set domains of sugar-utilizing enzymes 0.039
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000013367
Domain Number - Region: 765-797
Classification Level Classification E-value
Superfamily Plexin repeat 0.0314
Family Plexin repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013367   Gene: ENSPPYG00000011982   Transcript: ENSPPYT00000013913
Sequence length 1872
Comment pep:known chromosome:PPYG2:22:45944359:45962490:-1 gene:ENSPPYG00000011982 transcript:ENSPPYT00000013913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQLWALTLLGLLGAGASLRPRKLDFFRSEKELNHLAVDEASGVVYLGAVNALYQLDAK
LQLEQQVATGPALDNKKCTPPIEASQCHEAEMTDNVNQLLLLDPPRKRLVECGSLFKGIC
ALRALSNISLRLFYEDGSGEKSFVASNDEGVATVGLVSSTGPGGDRVLFVGKGNGPHDNG
IIVSTRLLDRTDSREAFEAYTDHATYKAGYLSTNTQQFVAAFEDGPYVFFVFNQQDKHPA
RNRTLLARMCREDPNYYSYLEMDLQCRDPDVHAAAFGTCLAASVAAPGSGRVLYAVFSRD
SRSSGGPGAGLCLFPLDEVHAKMEANRNACYTGTWEASRDIFYKPFHGEIQCGHALGSSK
SFPCGSEHLPYPLGSRDGLKATAVLQRGGLNLTAVTVTAENNHTVAFLGTSDGRILKVYL
TPDGTSSEYDSILVEINKRVKRDLVLSGDLASLYAMTQDKVFRLPVQECLSYPTCTQCRD
SQDPYCGWCVVEGRCTRKAECLRAEEASHWLWSRSKSCVAITSAQPQNMSRRAQGEVQLT
VSPLPALSEEDELLCLFGESPPHPARVEGEAVICNSPSSIPVTPPGQDHVAVTIQLLLRR
GNIFLTSYQYPFYDCRQAMSLEENLPCISCVSNRWTCQWDLRYHECREASPNPEDGIVRA
HMEDSCPQFLGPSPLVIPMNHETDVTFQGKNLDTVKGFSLHVGSDLLKFMEPVSMQESGT
FVFRTPKLSHDANETLPLHLYVKSYGKNIDSKLHVTLYSCSFGRSDCSLCRAANPDYRCA
WCGGQSRCVYEALCNTTSECPPPVITRIQPETGPLGGGIRITILGSNLGVRAGDIQRISV
AGRNCSFQPERYSVSTRIVCVIEAAEAPFTGGVEVDVFGKLGRSPPNVQFTFQQPQPLSV
EPQQGPQAGGTTLTIHGTHLDTGSQEDARVTLNGVPCKVTKFGAQLQCVTGPQATRGQML
LEVSYGGSPVPSPGIFFTYRENPVLRAFEPLRSFASGGRSINVTGQGFSLIQRFAMVVIA
EPLQSWQPPREAESPQPMTVVGTDYVFHNDTKVVFLSPAVPEEPEAYNLTVLIEMDGHRA
LLRTEAGAFEYVPDPTFENFTGGVKKQVNKLIHARGTNLNKAMTLQEAEAFVGAERCTMK
TLTETDLYCEPPEVQPPPKRRQKRDTTHNLPEFIVKFGSREWVLGRVEYDTRVSDVPLSL
ILPLVIVPMVVVIAVSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIEM
EDQTNDVHEAGIPVLDYKTYTDRVFFLPSKDGDKDVMITGKLDIPEPRRPVVEQALYQFS
NLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELLEQY
VVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDSAEPLYKLFKIKHQVEGPVDAVQKT
PIHSHDTGLLGTTEYAPLTVSVIVQDEGVDAIPVKVLNCDTISQVKEKIIDQVYRGQPCS
CWPRPDSVVLEWRPGSTAQILDLDLTSQREGRWKRVNTLMHYNVRDGATLILSKVGVSQQ
PEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVKEKERTKAITEIYLTRLL
SVKGTLQQFVDNFFQSVLAPGHVVPPAVKYFFDFLDEQAEKHNIQDEDTIHIWKTNSLPL
RFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLLYAKEIS
TYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEII
NALEEDPAAQKMQLAFRLQQIAAALENKEKGVQGQLTSPAPGTPEMTLGSPLTQRHGWSE
DQSKGVDCSLKC
Download sequence
Identical sequences H2P4W2
ENSPPYP00000013367 ENSPPYP00000013367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]