SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013438 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013438
Domain Number 1 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.17e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 70-128
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 411-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 275-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.21e-18
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013438   Gene: ENSPPYG00000012052   Transcript: ENSPPYT00000013987
Sequence length 473
Comment pep:known_by_projection chromosome:PPYG2:2a:3396303:3411285:-1 gene:ENSPPYG00000012052 transcript:ENSPPYT00000013987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTASGLALERAEGQEPSWEAITRPDIRRTPGRGRGIPLKASPSQNPALPPERFPGEEG
TTNSFLKARPWDLMTFEDVAVEFTQWEWGQLNPAQKDLYREVMLENFRNLAFLGLLVSKP
YVICQLEERGEPFMVEREISTGAHSDWERRSKSKESMPSWGISKEELFQVVSVEKHIQDV
LQFSKFKAACSCDGQLEMQQIKQERYLKQMSTTHKSATTLSRDYKWNGFGRSLGLRSVLV
NQHSVLMGEGSYKCDTEFRQTLGGNSSQRTHQEKKSFNCNECGKSFHFQSELRRHQRCHT
GEKPYECSDCGRAFGHISSLIKHQRTHTGEKPYECSECGRAFSQSSSLVLHYRFHTGEKP
YKCNECGRAFGHTSSLIKHQRTHTGEKPYECRECGRTFSQSSSLIVHYRFHTGEKPYKCN
KCGRAFSQSSSLTQHYRFHTGEKPYKCNECGRAFAHTASLIKHQRSHAGKKLL
Download sequence
Identical sequences H2P530
ENSPPYP00000013438 XP_002811680.1.23681 ENSPPYP00000013438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]