SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013445 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013445
Domain Number 1 Region: 214-311
Classification Level Classification E-value
Superfamily HMG-box 4.84e-22
Family HMG-box 0.0000275
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily HMG-box 3.01e-21
Family HMG-box 0.0000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013445   Gene: ENSPPYG00000012058   Transcript: ENSPPYT00000013994
Sequence length 384
Comment pep:novel chromosome:PPYG2:2a:3744592:3745743:-1 gene:ENSPPYG00000012058 transcript:ENSPPYT00000013994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPRSQSHWSNADILRLLECMENNLPSDDNGTFSSTQSHMDWGKVAFKNFSGEMCRLKW
LEISCSLRKFSTLKELVLEAKKCVKNTNESQKGRNHPDFPKRPLTAYIRFFKENWPQYSQ
MYPGMRSQELTKILSEKYKELPEQMKQKYIQDFQKEKQEFEEKLARFREEHPDLDQKGKK
SDISKRVQTKVQKKVQKNIEEVRSLQKTDRFFKKVKFHGEPQKPPMNGYHKFHQDSWSSK
ELQHLSLRERMVEIGRRWQRIPQSQKDHYKSQAEELQKQYKVKLDLWLKTLSPEDYAAYK
ESTYAKGKNMLMTGGPQSSSAKGLQEGFGEGQGLQAAGADASQTIWVNCHVSMEPEENRK
KDGEEEESSTSLDCSSGEEMEVDV
Download sequence
Identical sequences H2P537
XP_009234417.1.23681 ENSPPYP00000013445 ENSPPYP00000013445 9600.ENSPPYP00000013445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]