SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013468 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013468
Domain Number 1 Region: 151-376
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.12e-80
Family Actin/HSP70 0.00000029
Further Details:      
 
Domain Number 2 Region: 9-158
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.43e-53
Family Actin/HSP70 0.00000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013468   Gene: ENSPPYG00000012079   Transcript: ENSPPYT00000014017
Sequence length 376
Comment pep:known_by_projection chromosome:PPYG2:2a:5131748:5139816:-1 gene:ENSPPYG00000012079 transcript:ENSPPYT00000014017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGP
KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKN
REKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSI
MRVDIAGRDVSRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQ
YTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL
SGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSK
KEYEEDGSRAIHRKTF
Download sequence
Identical sequences H2P559 K7DJL7 P42025
ENSP00000289228 ENSPPYP00000013468 gi|11342680|ref|NP_005726.1| ENSP00000289228 9600.ENSPPYP00000013468 9606.ENSP00000289228 ENSPPYP00000013468 ENSP00000289228 NP_005726.1.87134 NP_005726.1.92137 XP_001155293.2.37143 XP_002811715.1.23681 XP_003806183.1.60992 XP_016804524.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]