SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013948 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013948
Domain Number 1 Region: 578-870
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-79
Family Protein kinases, catalytic subunit 0.0000256
Further Details:      
 
Domain Number 2 Region: 418-532
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-34
Family Pleckstrin-homology domain (PH domain) 0.0000293
Further Details:      
 
Domain Number 3 Region: 130-205
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.94e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0007
Further Details:      
 
Domain Number 4 Region: 257-322
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.5e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013948   Gene: ENSPPYG00000012489   Transcript: ENSPPYT00000014514
Sequence length 890
Comment pep:known_by_projection chromosome:PPYG2:2a:74468046:74531429:1 gene:ENSPPYG00000012489 transcript:ENSPPYT00000014514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTV
SFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHDMNSEN
ILQLITSADEIHEGDLVEVVLSALATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLVR
QGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSVPRPLQPEYVALPSEES
HVHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYTRPTICQYCKRLLKGLFRQGM
QCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSLGTDTDIPMDIDNNDINSDSSQGLDDT
EEPSPPEDKMFFLDPSDLDVERDEEAVKTISPSTSNNIPLMRVVQSIKHTKRKSSTMVKE
GWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPRDFTNISQG
SNPHCFEIITDTMVYFVGENNGDSSHNPVLAATGVGLDVAQSWEKAIRQALMPVTPQASV
CTSPGQGKDHKDLSTSISVSNCQIQENVDISTVYQIFADEVLGSGQFGIVYGGKHRKTGR
DVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHGDML
EMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVKLCD
FGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIIYVSLSGTFPFNEDE
DINDQIQNAAFMYPPNPWREISGEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTWLD
LREFETRIGERYITHESDDARWEIHAYTHNLVYPKHFIMAPNPDDMEEDP
Download sequence
Identical sequences H2P6H2
9600.ENSPPYP00000013948 XP_002812168.1.23681 ENSPPYP00000013948 ENSPPYP00000013948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]