SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014009 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014009
Domain Number 1 Region: 280-528
Classification Level Classification E-value
Superfamily SIS domain 3.34e-19
Family mono-SIS domain 0.0064
Further Details:      
 
Domain Number 2 Region: 29-279
Classification Level Classification E-value
Superfamily SIS domain 0.00000000921
Family mono-SIS domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014009   Gene: ENSPPYG00000012542   Transcript: ENSPPYT00000014576
Sequence length 625
Comment pep:known_by_projection chromosome:PPYG2:2a:84605694:84632388:-1 gene:ENSPPYG00000012542 transcript:ENSPPYT00000014576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKRFQHVIETPEPGKWELSGYEAAVPITEKSNPLTQELDKADAENIVRLLGQCDAEI
FQEEGQALPTYQRLYSESILTTMVQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVS
FNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISV
GLSAPFVAGQMDYCMNNTAVFLPVLVGFNPVSMARNDPIEDWSSTFRQVAERMQKIQEKQ
KAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDQGIAASQRCLLEILRTFE
RAHQVTYSQSPKIATLMKSVSTSLEKKGHVYLVGWQTLGIIAIMDGVECIHTFGADFRDV
RGFLIGDHSDMFNQKAELTNQGPQFTFSQEDLLTSILPSLTEIDTVVFIFTLDDNLMEVQ
TIVEQVKEKTSHIQALAHSTVGQTLPIRLKKLFPSIISITWPLLFFEYEGNFIQKFQREL
STKWVLNTVSTGAHVLLGKILQNHMLDLRISNSKLFWRALAMLQRFSGQSKARCIESLLR
AIHFPQPLSDDIRAAPISCHVQVAHEKDQVIPIALLSLLFRCSITEAQAHLAAAPSVCEA
VRSALAGPGQKRTADPLEILEPDVQ
Download sequence
Identical sequences H2P6N0
9600.ENSPPYP00000014009 ENSPPYP00000014009 XP_002812222.1.23681 ENSPPYP00000014009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]