SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014053 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014053
Domain Number 1 Region: 23-95
Classification Level Classification E-value
Superfamily HMG-box 1.44e-16
Family HMG-box 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014053   Gene: ENSPPYG00000012585   Transcript: ENSPPYT00000014621
Sequence length 357
Comment pep:novel chromosome:PPYG2:2a:86016900:86018484:-1 gene:ENSPPYG00000012585 transcript:ENSPPYT00000014621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKGPSYAPTPTPAPATQMPSTPGIPKPPKPPDKPLMRYMRYSRKFWDQVKASNPDLKLW
EIGKTIGGMWGDLTDEEKQENKYKAEKIEYNESMKTSNSTNLAYINAKSHAEAALEEESG
QRQSRMERGEPDVSIQLAEDPDDYADGFSMEHTDTARFQRNHGLISEILSDGVVPDVPSA
VTTARMQVLKRQVQSLMVHQKLEAELLQTEEHQEKKRKFLESTASFTSELKRFCSLKVEL
DMEKTVAEIAQTEEQGRKRQEEKKEAAVQAERSQSSLVPEEEQAGNKGEEKKDDTNLPRE
TEETHSEEGQQNSEEGKSTPEDKESGEGTSDSNTGSESNSTVEEPPTDPIPRDEKKE
Download sequence
Identical sequences H2P6S3
ENSPPYP00000014053 ENSPPYP00000014053 9600.ENSPPYP00000014053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]