SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014505 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014505
Domain Number 1 Region: 319-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000139
Family HkH motif-containing C2H2 finger 0.054
Further Details:      
 
Domain Number 2 Region: 114-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000216
Family HkH motif-containing C2H2 finger 0.04
Further Details:      
 
Domain Number 3 Region: 260-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000214
Family Classic zinc finger, C2H2 0.056
Further Details:      
 
Domain Number 4 Region: 19-65
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000238
Family HkH motif-containing C2H2 finger 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014505   Gene: ENSPPYG00000012984   Transcript: ENSPPYT00000015092
Sequence length 471
Comment pep:known_by_projection chromosome:PPYG2:2b:69706828:70070804:-1 gene:ENSPPYG00000012984 transcript:ENSPPYT00000015092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMANFLRGFEEKGIKNDRPEEQLSKEKKKILFSFCEVCNIQLNSAAQAQVHSNGKSHRK
RVKQLSDGQPPPPAQASPSSNSSTGSTCNTTTLPALVRTPTLMMQPSLDIKPFMSFPVDS
SSAVGLFPNFNTMDPVQKAVINHTFGVSIPPKKKQVISCNVCQLRFNSDSQAEAHYKGSK
HAKKVKALEATKNKPKMVPSKDSAKANPSCSITPITGNNSDKSEDKGKSKASSSSQPSSS
ESGSFLLKSGTTPLPPGAATSPSKSTNGAPGTVVESEEEKAKKLLYCSLCKVAVNSLSQL
EAHNTGSKHKTMVEARNGAGPIKSYPRPGSRLKMQNGSKGSGLQNKTFHCEICDVHVNSE
IQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSPSILAAKLAFQKDMMKPLAPAFLSSP
LAAAAAVSSALSLPPRPSASLFQAPAIPPALLRPGHGPIRATPASILFAPY
Download sequence
Identical sequences H2P807
9600.ENSPPYP00000014505 ENSPPYP00000014505 ENSPPYP00000014505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]