SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014770 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014770
Domain Number 1 Region: 554-846
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-83
Family Protein kinases, catalytic subunit 0.000000000528
Further Details:      
 
Domain Number 2 Region: 1-144
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.53e-65
Family Ephrin receptor ligand binding domain 0.00000238
Further Details:      
 
Domain Number 3 Region: 269-473
Classification Level Classification E-value
Superfamily Fibronectin type III 8.74e-40
Family Fibronectin type III 0.00013
Further Details:      
 
Domain Number 4 Region: 852-922
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.19e-20
Family SAM (sterile alpha motif) domain 0.000052
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000014770
Domain Number - Region: 200-271,307-330
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000785
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014770   Gene: ENSPPYG00000013217   Transcript: ENSPPYT00000015367
Sequence length 927
Comment pep:known_by_projection chromosome:PPYG2:2b:113377628:113525142:-1 gene:ENSPPYG00000013217 transcript:ENSPPYT00000015367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCK
ETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKK
GFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEE
KDVPKMYCGADGEWLVPIGNCLCNAGHEERSGECQACKIGYYKALSTDATCAKCPPHSYS
VWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQD
ISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGV
SKYNPNPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYY
EKDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRI
IGDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDP
FTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGY
TDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFT
VIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAY
TTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEE
GYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPN
TALLDPSSPEFSAAVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAI
THQNKILSSVQAMRTQMQQIHGRMVPV
Download sequence
Identical sequences H2P8Q7
XP_009236434.1.23681 ENSPPYP00000014770 ENSPPYP00000014770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]