SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015315 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015315
Domain Number 1 Region: 180-245
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000034
Family HMG-box 0.0000739
Further Details:      
 
Domain Number 2 Region: 78-123
Classification Level Classification E-value
Superfamily HMG-box 0.000000183
Family HMG-box 0.00024
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000015315
Domain Number - Region: 363-432
Classification Level Classification E-value
Superfamily HMG-box 0.00295
Family HMG-box 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015315   Gene: ENSPPYG00000013695   Transcript: ENSPPYT00000015925
Sequence length 450
Comment pep:novel chromosome:PPYG2:3:65037878:65042159:1 gene:ENSPPYG00000013695 transcript:ENSPPYT00000015925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNREASPTDLEMAAFKGQDHWSQEDMLTLLECIKNNLPTNSSYKFKTTSHMDKVAFKSGD
VRKLCTLTELILNQKHVKNPKHPDFPKKSLIPYFHFFMEKQAKCAKLHPEISNLDFTKIL
SKKKELPEKKDHPNLMKNAKKPDIPKKLNSPTQQLWYTHYIEEHPEPNIIEEGPTKSTLA
KAEHQLKDKFDGRPTKPPWNSYSLYCAELMANIKDVPSTERMMPGQQWKLLSWKEKDAYE
EQQQVLWGERVLNINKKHATCPASKKPGQLQEEQPGFLESEPACMLAPRWSDLSEKSKPG
RECQELGKPPKSPKRVQEIWQQSVISNYLACFKKENLMIEKGAKDRKRRELSEMWALPAA
TDSSKMMKFQRGSKKPYQKFFQELLCNGELKHLPQTELTVDGNWQISWSQKEHYKKLANE
QKYKVHLDAWVKGSSSSSSSSGDSSDPESS
Download sequence
Identical sequences H2PA71
9600.ENSPPYP00000015315 ENSPPYP00000015315 ENSPPYP00000015315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]