SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015469 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015469
Domain Number 1 Region: 236-311
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00013
Further Details:      
 
Domain Number 2 Region: 99-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.05e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 11-85
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000896
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015469   Gene: ENSPPYG00000013822   Transcript: ENSPPYT00000016083
Sequence length 403
Comment pep:known_by_projection chromosome:PPYG2:3:94392628:94403672:1 gene:ENSPPYG00000013822 transcript:ENSPPYT00000016083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSDGGLEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPE
RITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGNVSRPPVTLRLVIPASQCGSLIGKA
GTKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGATI
PYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQ
TSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGERHVTITGSPVSIAL
AQYLITACLETAKSTSGGTPSSAPADLPAPFSPPLTALPTAPPGLLGTPYAISLSNFIGL
KPVPFLALPPASPGPPPGLAAYTAKMAAANGSKKAERQKFSPY
Download sequence
Identical sequences F7HYV5 H2PAL6
ENSCJAP00000010746 ENSPPYP00000015469 XP_002758447.1.60252 XP_002758449.1.60252 XP_002813715.1.23681 XP_003776278.1.23681 XP_009237227.1.23681 ENSPPYP00000015469 9600.ENSPPYP00000015469 ENSCJAP00000010813 ENSCJAP00000010833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]