SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015555 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015555
Domain Number 1 Region: 28-416
Classification Level Classification E-value
Superfamily Sema domain 5.49e-98
Family Sema domain 0.00058
Further Details:      
 
Domain Number 2 Region: 1524-1549,1737-1888
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.02e-29
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 1004-1099
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000374
Family Other IPT/TIG domains 0.0085
Further Details:      
 
Domain Number 4 Region: 1096-1186
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000224
Family Other IPT/TIG domains 0.037
Further Details:      
 
Domain Number 5 Region: 419-470
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000432
Family Plexin repeat 0.0028
Further Details:      
 
Domain Number 6 Region: 1186-1230,1260-1313
Classification Level Classification E-value
Superfamily E set domains 0.0000000000133
Family Other IPT/TIG domains 0.048
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000015555
Domain Number - Region: 963-1004
Classification Level Classification E-value
Superfamily Plexin repeat 0.0117
Family Plexin repeat 0.003
Further Details:      
 
Domain Number - Region: 575-607
Classification Level Classification E-value
Superfamily Plexin repeat 0.0123
Family Plexin repeat 0.0081
Further Details:      
 
Domain Number - Region: 1328-1379
Classification Level Classification E-value
Superfamily E set domains 0.0857
Family E-set domains of sugar-utilizing enzymes 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015555   Gene: ENSPPYG00000013906   Transcript: ENSPPYT00000016174
Sequence length 1956
Comment pep:known_by_projection chromosome:PPYG2:3:98123701:98144801:1 gene:ENSPPYG00000013906 transcript:ENSPPYT00000016174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALGPALLQALWAGWVLTLQPLPPAAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSP
GLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCE
QRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQ
SRAFRAYVSRVCLRQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGVAYIEYDVNSD
CAQLPPDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGTQLTAVAVTMEDGHTIAFLGD
SQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCA
QHLDCASCLAHRDPYCGWCVLLGRCSHRSECSRGQGPEQWLWSFQSELGCLQVAAMSPAN
ISREETREVFLSVPDLPPLWPGESYSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGA
DYVSVSVELRFGAVVIAKTSLSFYDCVAVTELRPSAQCQACVSSRWGCNWCVWQHLCTHK
ASCDAGPMVASHQSPLVSPDPPARDGPSPSPPIAPKALVTPAPDTLPVEPGAPSTATASD
ISPGASPSLLSPWGPWAGSGPISSPGSTESPLHEEPSPPRPTNGPGTALPAPTDFRPSAT
PEDLLASPLSPSEVAAVPPADPGPEALHPTVPLDLPPATVPATTFPGAMGSVKPALDWLT
REGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQYDTPGLWEL
EEVTSGASSCPCVESVQGSTLMPVHVEREIRLLGRNLHLFQDGPGDNECVMELEGLEVVV
EARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLYDCS
VGHGDCSRCQTAMPQYGCVWCEGEHPRCVTREACGEAEAVATQCPAPLIHSVEPLTGPID
GGTRVTIRGSNLGQHVQDVLGMVTVAGVPCAVDAQEYEVSSSLVCITGASGEEVAGAAAV
EVPGRGRGVSEHDFAYQDPKVHSIFPARGPRAGGTRLTLNGSKLLTGRLEDIRVVVGDQP
CHLLPEQQSEQLRCETSPRPTPATLPVAVWFGATERRLQRGQFKYTFDPNITSAGPTKSF
LSGGREIWVRGQNLDVVQTPRIRVTVVSRMLQPSQGLGRRRRVVPETACSLGPSCSGQQF
EEPCHVNSSQLITCHTPALPGLPEDPWVQVEFILDNLVFDFATLNPTPFSYEADPTLQPL
NPEDPTMPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPPVEQ
PLPRHHALREAPDSLPEFTVQMGNLRFSLGHVQYDGESPGAFPVAAQVGLGVGTSLLALG
VIIIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLGSGI
PFLDYKVYAERIFFPWHRESPDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRL
LREDVEYRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPD
PRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLR
ENQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPEIYL
TRLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIWKTN
SLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYA
RDIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGAPLALHELYKWINRYY
DQIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences H2PAV0
ENSPPYP00000015555 9600.ENSPPYP00000015555 ENSPPYP00000015555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]