SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016249 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016249
Domain Number 1 Region: 21-102
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000196
Family HLH, helix-loop-helix DNA-binding domain 0.0000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016249   Gene: ENSPPYG00000014540   Transcript: ENSPPYT00000016905
Sequence length 178
Comment pep:known_by_projection chromosome:PPYG2:4:2256573:2267937:-1 gene:ENSPPYG00000014540 transcript:ENSPPYT00000016905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPSTGIRQEKQGGQLVRKAPNNRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDSTRHTT
LSLLKRAKVHIKKLEEQDRRALSIKEQLQQEHRFLKRRLEQLSVQSVERVRTDSTGSAVS
TDDSEQEVDIEGMEFGPGELDSVGSSSDADDHYSLQSGTGGDSGFGPHCRRLGRPALS
Download sequence
Identical sequences H2PCQ5
ENSPPYP00000016249 ENSPPYP00000016249 9600.ENSPPYP00000016249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]