SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016383 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016383
Domain Number 1 Region: 773-954
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.05e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0037
Further Details:      
 
Domain Number 2 Region: 158-192,231-377
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-32
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 3 Region: 929-1048
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.05e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 4 Region: 3-163
Classification Level Classification E-value
Superfamily PH domain-like 7.65e-21
Family Phosphotyrosine-binding domain (PTB) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016383   Gene: ENSPPYG00000014663   Transcript: ENSPPYT00000017049
Sequence length 1168
Comment pep:known_by_projection chromosome:PPYG2:4:38941860:39185385:1 gene:ENSPPYG00000014663 transcript:ENSPPYT00000017049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHPLPNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSRQSSRKEPV
TKQVRLCVSPSGLRCEPEPGRSQQWDPLIYSNIFECKPQRVHKLIHNSHDPSYFACLIKE
DAVHRQSICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFSKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSGSRGSESLRPDPPHAAPTGSQEPGRRPMRKSFSQPG
LRSLAFRKELQDGGLRSSGFFSSFEESDIENHLISGHNIVQPTDIEENRTMLFTIGQSEV
YLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCTNEALV
DEIMMTLKQAFTVAAVQRTAKAPAQLCEGCPLQGLHKLCERIEGMNSSKTKLELQKHLTT
LTNQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKEHIHIWEMKQTSQMAAENI
GSELPPSATRFRLDMLKNKAKRSLTESLESILSRGNKARGLQEHSTSVDLDSSVSSTLSN
TSKEPSVCEKEALPISESSFKLLGSSEDLSSDSESHLPEEPAPLSPQQAFRRRANTLSHF
PMECQEPPQPARGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHS
WRQQIFLRVATPQKVCDSSSRYEDYSELGELPPRSPLEPVCEDGPFGPPPEEKKRTSCEL
RELWQKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTTVWEKMLST
PGRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHQFSSKQQPKDVPYKELLKQ
LTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGIL
LLHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEI
GPSLYAAPWFLTMFASQFPLGFVARVFDMIFLQGTEVIFKVALSLLGSHKPLILQHENLE
TIVDFIKSTLPNLGLVQMEKTINQVFEMDIAKQLQAYEVEYHVLQEELIDSSPLSDNQRM
DKLEKTNSSLRKQNLDLLEQLQVANGRIQSLEATIEKLLSSESKLKQAMLTLELERKALL
QTVEELRRRSAEPSDRQPECTQPEPTGY
Download sequence
Identical sequences H2PD36
9600.ENSPPYP00000016383 XP_002814705.1.23681 ENSPPYP00000016383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]