SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016776 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016776
Domain Number 1 Region: 615-875
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.6e-81
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 281-383
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000562
Further Details:      
 
Domain Number 3 Region: 499-600
Classification Level Classification E-value
Superfamily SRCR-like 1.09e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 
Domain Number 4 Region: 388-488
Classification Level Classification E-value
Superfamily SRCR-like 1.03e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 5 Region: 168-271
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.001
Further Details:      
 
Domain Number 6 Region: 100-172
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-16
Family Kringle modules 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016776   Gene: ENSPPYG00000015019   Transcript: ENSPPYT00000017456
Sequence length 876
Comment pep:known_by_projection chromosome:PPYG2:4:123211964:123290621:-1 gene:ENSPPYG00000015019 transcript:ENSPPYT00000017456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLARFVLALVLGALPEVVGFDSVLDSLHHRHRHRHSPPPGLQYPYYLPTQQRPPRTRPP
PPLPRFPRPPRALPAQRPHALQAGHTPRPHPWGCPAGEPWVSVTDFGAPCLQWAEVPPFL
ERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGKNEF
EGTVEVYARGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRC
QGDEENILLCEKDIWQGGVCPQKMAAAVTCSFSHGPTFPIIRLVGGSSVHEGRVELYHAG
QWGTVCDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQC
PKSSWGEHNCGHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTEL
NTYVVCRQLGFKFGKQASANHFEESTGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHRE
DVSIACYPGGEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICR
QLGYKGPARARTMAYFGEGKGPIHVDNVRCTGNERSLADCIKQDIGRHNCRHSEDAGVIC
DYFGKKASGNSNKESLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDGRL
LCGATLLSSCWVLTAAHCFKRYGNSTRNYAVRVGDYHTLVPEEFEEEVGVQQIVIHREYR
PDSSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSR
TLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWV
VYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTKL
Download sequence
Identical sequences H2PE67
ENSPPYP00000016776 ENSPPYP00000016776 9600.ENSPPYP00000016776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]