SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017027 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017027
Domain Number 1 Region: 54-79,125-166
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000381
Family HLH, helix-loop-helix DNA-binding domain 0.0047
Further Details:      
 
Domain Number 2 Region: 165-208
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000418
Family Hairy Orange domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017027   Gene: ENSPPYG00000015241   Transcript: ENSPPYT00000017718
Sequence length 328
Comment pep:known_by_projection chromosome:PPYG2:4:193269281:193271139:1 gene:ENSPPYG00000015241 transcript:ENSPPYT00000017718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLKERKVSQLSPNGTCALVVEASDSPTHHLGGPMAGKCPHGTLSVEESRVRTPVSHKVIE
KRRRDRINRCLNELGKTVPMALAKQGEPREALAQIRSRVLSLVLSSATVPALAGAGRCEG
PFPPFCRVPGKLEKAEILEMTLQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKN
LVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFA
GSQPGARPLLFPQGFWGPGLSPGPPGAGPQPRPCPYLPSAPVPLASPAQQPSPFLTPVQG
LDRHYLNLIGHAHPNALNLHTPQHPPVL
Download sequence
Identical sequences H2PEV6
9600.ENSPPYP00000017027 ENSPPYP00000017027 ENSPPYP00000017027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]