SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017154 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017154
Domain Number 1 Region: 46-797
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.23e-270
Family Motor proteins 0.000000000148
Further Details:      
 
Domain Number 2 Region: 1213-1299
Classification Level Classification E-value
Superfamily PH domain-like 8.49e-24
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 
Domain Number 3 Region: 1360-1479
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-21
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1763-1832,1875-1919
Classification Level Classification E-value
Superfamily Second domain of FERM 1.07e-17
Family Second domain of FERM 0.0085
Further Details:      
 
Domain Number 5 Region: 1302-1352
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000784
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 1175-1213
Classification Level Classification E-value
Superfamily PH domain-like 0.000000178
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000017154
Domain Number - Region: 821-930,1215-1240
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000513
Family BAR domain 0.031
Further Details:      
 
Domain Number - Region: 1670-1756
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.021
Family Ras-binding domain, RBD 0.024
Further Details:      
 
Domain Number - Region: 1923-2009
Classification Level Classification E-value
Superfamily PH domain-like 0.0486
Family Third domain of FERM 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017154   Gene: ENSPPYG00000015356   Transcript: ENSPPYT00000017849
Sequence length 2027
Comment pep:known_by_projection chromosome:PPYG2:5:17503988:17734956:-1 gene:ENSPPYG00000015356 transcript:ENSPPYT00000017849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDKRFFFKGTRVWLRENGQHFPSTVNSCAEGIVVFRTDYGQVFTYKQSTITHQKVTAMHP
TNEEGVDDMASLTELHGGSIMYNLFQRYKRNQIYTYIGSILASVNPYQPIAGLYEPATME
QYSRRHLGELPPHIFAIANECYRCLWKRHDNQCILISGESGAGKTESTKLILKFLSVISQ
QSLELSLKEKTSCVERAILESSPIMEAFGNAKTVYNNNSSRFGKFVQLNICQKGNIQGGR
IVDYLLEKNRVVRQNPGERNYHIFYALLAGLEHEEREEFYLSTPENYHYLNQSGCVEDKT
ISDQESFREVITAMDVMQFSKEEVREVSRLLAGILHLGNIEFITAGGAQVSFKTALGRSA
ELLGLDPTQLTDALTQRSMFLRGEEILTPLNVQQAVDSRDSLAMALYACCFEWVIKKINS
RIKGNEDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGL
VWEDIDWIDNGECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHSQHANNHFYVKPRV
AVNNFGVKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDT
LKCGSKHRRPTVSSQFKDSLHSLMATLSSSNPFFVRCIKPNMQKMPDQFDQAVVLNQLRY
SGMLETVRIRKAGYAVRRPFQDFYKRYKVLMRNLALPEDIRGKCTSLLQLYDASNSEWQL
GKTKVFLRESLEQKLEKRREEEVTHAAMVIRAHVLGFLARKQYRKVLYCVVIIQKNYRAF
LLRRRFLHLKKAAVVFQKQLRGQIARRVYRQLLAEKREQEEKKKQEEEEKKKREEEERER
ERERREAELRAQQEEEMRKQQELEALQESQKEAELTRELEKQKENKQVEEILRLEKEIED
LQRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDEIDECVRNIER
SLSVGSEFSSELAASACEEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQR
TSGIRTSDDSSEEDPYMNDTVVPTSPSADSTVLLAPSVQDSGSLHNSSSGESTYCMPQNA
GDLPSPDGDYDYDQDDYEDGAITSGSSVTFSNSCGSQWSPDYRCSVGTYNSSGAYRFSSE
GAQSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVTLPYFHSFLYMKGGLMNSWKRRWCVL
KDETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSKLMYFENDSEEKLKG
TVEVRTAKEIIDNTTKENGIDIIMADRTFHLIAESPEDAGTLDVGLIDSVCASDSPDRPN
SFVIITANRVLHCNADTPEEMHHWITLLQRSKGDTRVEGQEFIVRGWLHKEVKNSPKMSS
LKLKKRWFVLTHNSLDYYKSSEKNALKLGTLVLNSLCSVVPPDEKIFKETGYWNVTVYGR
KHCYRLYTKLLNEATRWSSAIQNVTDTKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNP
ILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLESMSDPIPIIQG
ILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKF
HLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGS
CKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKL
AATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLA
ALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFTPCERLEKRRTSFLEGTLRR
SFRTGSVVRQKVEEEQMLDMWIKEEVSSARASIIDKWKKFQGMNQEQAMAKYMALIKEWP
GYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYK
IVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTTRSASSQGSSR
Download sequence
Identical sequences H2PF80
9600.ENSPPYP00000017154 ENSPPYP00000017154 ENSPPYP00000017154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]