SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017998 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017998
Domain Number 1 Region: 44-111
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000138
Family HkH motif-containing C2H2 finger 0.00053
Further Details:      
 
Domain Number 2 Region: 192-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000714
Family HkH motif-containing C2H2 finger 0.012
Further Details:      
 
Domain Number 3 Region: 253-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000527
Family HkH motif-containing C2H2 finger 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017998   Gene: ENSPPYG00000016082   Transcript: ENSPPYT00000018717
Sequence length 291
Comment pep:known_by_projection chromosome:PPYG2:5:179694839:179737878:1 gene:ENSPPYG00000016082 transcript:ENSPPYT00000018717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYPAPAAVQAADGGGAGPYNSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVE
HMIQKNQCLFTNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKL
DSDQPASRLVCDRNAGCPLCPAFTFHFSFTASAHFLDKGKHGRVPHPAVGLTALSKRLTN
PFLVASTLALHQNREMIDPDKFCSLCHATFNDPVMAQHYVGKKHRKQETKLKLMARYGRL
ADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLG
Download sequence
Identical sequences H2PHH4
ENSPPYP00000017998 ENSPPYP00000017998 9600.ENSPPYP00000017998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]