SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018598 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018598
Domain Number 1 Region: 1241-1344,1398-1565
Classification Level Classification E-value
Superfamily Cullin homology domain 5.75e-41
Family Cullin homology domain 0.0005
Further Details:      
 
Domain Number 2 Region: 809-1001
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.64e-35
Family APC10-like 0.0057
Further Details:      
 
Domain Number 3 Region: 392-466
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.29e-31
Family CPH domain 0.00000663
Further Details:      
 
Domain Number 4 Region: 114-195,505-594,669-796
Classification Level Classification E-value
Superfamily ARM repeat 0.00000155
Family Regulatory subunit H of the V-type ATPase 0.054
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000018598
Domain Number - Region: 1575-1671
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0145
Family Penicillinase repressor 0.036
Further Details:      
 
Domain Number - Region: 993-1102
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.0523
Family Cullin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018598   Gene: ENSPPYG00000016629   Transcript: ENSPPYT00000019337
Sequence length 1723
Comment pep:known_by_projection chromosome:PPYG2:6:43114270:43133640:-1 gene:ENSPPYG00000016629 transcript:ENSPPYT00000019337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDC
KAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESTGEVGALDKSVLEEMETDVKSLIQR
ALRQLEECVGTIPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWS
AGRMIQALSSHDAGEGQCGEEGKAGEGLGRLRDSQDTVAGASDLIRTRTQILLSLSQQEA
IEKHLDFDSRCALLALFAQATLSEHPMSFEGIQLPQVPGRVLFSLVKRYLHVTSLLDQLN
DSAAEPGAQNTSAPEEWSGERGQLELEFSMAMGTLISELVQAMRWDQASDRPRSSARSPG
SIFQPQLADVSPGLPATQAQPSFRRSRRFRPRSEFASGNTYALYVRDTLQPGMRVRMLDE
YEEISAGDEGEFRQSNNGVPPVQVLWESTGRTYWVHWHMLEILGFEEDIEDMVEADEYQG
AVASRVLGRALPAWRWRPMTELYAVPYVLPEDEDSEECEHLTLAEWWELLFFIKKLDGPD
HQEVLQILQENLDGEILDDEILAELAVPIELAQDLLLTLPQRLNDSALRDLINCHVYKKY
GPEALAGNPAYPSLLEAQEDVLLEAQAQAKDSEDAAKVEAKEPPSQSPNTPLQRLVEGYG
PAGKILLDLEQALSSEGTQENKVKPLLLQLQRQPQPFLALMQSLDTPETNRTLHLTVLRI
LKQLVDFPEALLLPWHEAVDACMACLRSPNTDREVLQELIFFLHRLTSVSRDYAVVLNQL
GARDAISKALEKHLGKLELAQELRDMVFKCEKHAHLYRKLITNILGGCIQMVLGQIEDHR
RTHRPINIPFFDVFLRYLCQGSSVEVKEDKCWEKVEVSSNPHRASKLTDRNPKTYWESNG
SAGSHYITLHMRQGILIRQLTLLVASEDSSYMPARVVVCGGDSTSSLHTELNSVNVMPSA
SRVILLENLTRFWPIIQIRIKRCQQGGIDTRIRGLEILGPKPTFWPVFREQLCRHTRLFY
MVRAQAWSQDMAEDRRSLLHLSSRLNGALRQEQNFADRFLPDNEAAQALGKTCWEALVSP
VVQNITSPDEDGISPLGWLLDQYLECQEAVFNPQSRGPAFFSRVRRLTHLLVHVECEAPP
PVVATPRPKGRNRSHDWSSLATRGLPSSIMRNLTRCWRAVVEKQVNNFLTSSWRDDDFTQ
CEKTLSIIVNIANLYNPRPSSPLTCSAGLFMAFLCSAIAQVSEQFARHIDQQIQGSRIGG
AQEMERLAQLQQCLQAVLIFSGLEIATTFEHYYQHYMADRLLGVVSSWLEGAVLEQIGPC
FPNRLPQQMLQSLSTSKELQRQFHVYQLQQLDQELLKLEDTEKKIQVGHGASGKEHKSEK
EEEAGAAAAVDVAEGEEEEEENEDLYYEGAMPEVSVLVLSRHCWPVASICHTLNPRTCLP
SYLRGTLNRYSNFYNKSQSHPALERGSQRRLQWTWLGWAELQFGNQTLHVSTVQMWLLLY
LNDLKAVSVESLLALSGLSADMLNQAIGPLTSSRGPLDLHEQKDIPGGVLKIRDGSKEPR
SRWDIVRLIPPQTYLQAEGEEGRNLEKRRNLLNCLIVRILKAHGDEGLHIDQLVCLVLEA
WQKGPCPPRGLVSSLGKGSACSSTDVLSCILHLLGKGTLRRHDDRPQVLSYAVPVTVMEP
HTESLNPGSSGPNPPLTFHTVQIRSRGVPYASCTATQSFSTFR
Download sequence
Identical sequences H2PJ39
9600.ENSPPYP00000018598 ENSPPYP00000018598 ENSPPYP00000018598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]