SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018880 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018880
Domain Number 1 Region: 574-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000385
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 611-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000174
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 100-130
Classification Level Classification E-value
Superfamily SET domain 0.00000563
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 142-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000827
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018880   Gene: ENSPPYG00000016866   Transcript: ENSPPYT00000019626
Sequence length 708
Comment pep:known_by_projection chromosome:PPYG2:6:101175463:101183418:1 gene:ENSPPYG00000016866 transcript:ENSPPYT00000019626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVLTIQTSAHCVR
MVRGELVDESGGSPLEWIGLIRAARNSQEQTLEAIADLPGGQIFYRALRDVQPGEELTVW
YSNSLAQWFDIPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVFSGGGGGAF
LHHEHAARQGAVPAADGLGLSPKPPAPDFTAPSQAGTLRPHPQGPPPVQACGAREGIKRE
ASSAPSATSPTPGKWGQPKKGKEQLDRALDMSGAARGQGHFLGIVGGSSAGVGSLAFYPG
VRSAFKPAGLERAAAAAHGDPYREESSNKQGAGLALGRLLGGGRACGRPGSGENSAHHAH
HHHHPKCLLAGDPPPPPPPGLPCSGALRGFPLLSVPPEEASAFKHVERAPPAAAALPGAR
YAQLPPAPGLPLERCALPPLDTGGLKAYPGGECSHLPAVMPAFTVYNGELFYGSPATTAY
YPLKLHFGGLLKYPESISYFSRPAAAALSPAELGSLASIDREIAMHNQQLSEMAAGKGRG
RLDSGTLPPAVAAAGGTGGGGSGGSGAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYK
PLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQSLL
AKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVGGGGERDL
Download sequence
Identical sequences H2PJW1
9600.ENSPPYP00000018880 ENSPPYP00000018880 ENSPPYP00000018880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]