SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019264 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019264
Domain Number 1 Region: 220-416
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-39
Family SPRY domain 0.00028
Further Details:      
 
Domain Number 2 Region: 80-149
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000424
Family RING finger domain, C3HC4 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019264   Gene: ENSPPYG00000017198   Transcript: ENSPPYT00000020022
Sequence length 419
Comment pep:known_by_projection chromosome:PPYG2:6_cox_hap1:161620:167283:-1 gene:ENSPPYG00000017198 transcript:ENSPPYT00000020022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWRDLPRLRLWLKRQAIPGEGRKAAKVNAGVGEKGIYTASSSGGPPSARSKAVTVVAEG
AASRSWLSMDAPELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRGTPPA
TGTEASPTACPCCGLPCPRRSLRSNVRLAVEVRISRELREKLAEPGARARRRRGGRIPTM
GCLDLPGEDMRKTWRRFEVPIPKSSNSEDDLPEDYPVVKNMLHRLTADLTLDPGTAHRRL
LISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFGAGRHCWEVETADAASCRDSSG
EDEDDEESHYAVGAAGESVQPKGCVRLCPAGAVWAVEGRGGRLWALTAPEPTLLGGVEPP
PRRIRVDLDWERGRVAFYDGRSLDLLYAFQTPGPLGERIFPLFCTCDPRAPLRIVPAES
Download sequence
Identical sequences H2PKY6
ENSPPYP00000019264 9600.ENSPPYP00000019264 ENSPPYP00000019264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]