SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019338 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019338
Domain Number 1 Region: 82-199
Classification Level Classification E-value
Superfamily POZ domain 4.45e-27
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 556-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000109
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000019338
Domain Number - Region: 531-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000206
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019338   Gene: ENSPPYG00000017249   Transcript: ENSPPYT00000020097
Sequence length 683
Comment pep:known_by_projection chromosome:PPYG2:6_qbl_hap2:1154873:1157831:-1 gene:ENSPPYG00000017249 transcript:ENSPPYT00000020097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDGGGRGPGCCCGRRVRGGGGPGARGPRPPRPPSSFLCSCGWGGIPSLHNMEPSPLSPSG
AALPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVSIRVQGREFRA
HRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLASAYTGRLSMAAADIVNFLTV
GSVLQMWHIVDKCTELLREGRASATTTITTAAATSVTVPGAGVPSGSGGSVAPATMGSAR
SHASSRASENQSPSSSNYFSPRESTDFSSSSQEAFAASAVGSGERRGGGPVFPAPVVGSG
GATSGKLLLEADELCDDGGDGRGAVVPGAGLRKPTYTPPSIMPQKHWVYVKRGGNCPAPA
PLVPQDPDLEEEEEEEDLVLTCEDDEDEELGGSSRVPVGGGPEATLSISDVRTLSEPPDK
GEEQVNFCESSNDFGPYEGGGPVAGLDDSGGPTPSSYAPSHPPRPLLPLDMQGNQILVFP
SSSSSSSQAPGQPPGNQAEHGAVTVGGTSVGSLGVPGSVGGVPGGTGSGDGNKIFLCHCG
KAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYECGVCAKKFM
WRDSFMRHRGHCERRHRLGGVGAGPGPGTPTGPSLPSKRESPGAGGGSGDEASAATPPSS
RRVWSPPSVHKVEMGFGGGGGAN
Download sequence
Identical sequences H2PL60
9600.ENSPPYP00000019338 ENSPPYP00000019338 ENSPPYP00000019338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]