SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019483 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019483
Domain Number 1 Region: 311-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 352-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.64e-20
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 256-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 217-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 5 Region: 95-129
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000128
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019483   Gene: ENSPPYG00000017385   Transcript: ENSPPYT00000020252
Sequence length 416
Comment pep:known_by_projection chromosome:PPYG2:7:8531313:8542771:1 gene:ENSPPYG00000017385 transcript:ENSPPYT00000020252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPCHGQGEQEETALCRGTWEPGIQLGPVEVKPEWGMPPGEGVQGPDPGTEEQLSQDPGDE
TRAFQEQPLPVLQAGPGLPAMNPRDQEMAAGFFTAGSQGLGPFKDMALAFPEEEWRHVTP
AQIDCFGEYVEPQDCRVSPGGGSKEKEAKPPQEDLKGALVALTSERFGEASLQGPGLGRA
CEQEPGGSAGGAPGLPPPQHGAIPLPDEVKTHSSFWKPFQCPECGKGFSRSSNLVRHQRT
HEEEKSYGCVECGKGFTLREYLMKHQRTHLGKRPYVCSECWKTFSQRHHLEVHQRSHTGE
KPYKCGDCWKSFSRRQHLQVHRRTHTGEKPYTCECGKSFSRNANLAVHRRAHTGEKPYGC
QVCGKRFSKGERLVRHQRIHTGEKPYHCPACGRSFNQRSILNRHQKTQHRQEPLVQ
Download sequence
Identical sequences H2PLK1
9600.ENSPPYP00000019483 ENSPPYP00000019483 ENSPPYP00000019483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]